Table 1

Aminoacid sequences of the ectodomain (α1–α3 domains) of the MICA*001 allele, of BLS, the linker and the chimeric protein BLS-MICA

Sequence
Ectodomain of MICA*001MHEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQ GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIR VCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNV RNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTR SEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGN GTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS
BLSTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVEVEIFDVPGAYEIPLH AKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLETEVPVLSV VLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIALV
Peptide linkerGSGSGLK
Chimeric BLS-MICA proteinMHEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQW AEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHED NSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKT KTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRAS GFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRF TCYMEHSGNHSTHPVPSGSGSGLKTSFKIAFIQARWHADIVDEARKSFVAEL AAKTGGSVEVEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHD FVATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEA AHAALQIVSERSRIALV
  • BLS, Brucella lumazine synthase; BLS-MICA, BLS coupled to MICA; MICA, MHC class I chain-related protein A.